Peptide Blends
CJC-1295 + Ipamorelin
A dual-component research blend containing CJC-1295 No DAC, a GHRH analog, and Ipamorelin, a growth-hormone secretagogue peptide. VitalCore supplies CJC-1295 + Ipamorelin as a high-purity material for analytical and in-vitro laboratory research only.
$80.00 10 mg
In stock
Not for human or veterinary use. Supplied for laboratory research only.
Volume pricing
Each at $80.00
Quantity
- HPLC + MS verified
- COA for every lot
- Tracked, insured shipping
- Secure checkout
Free shipping on orders over $99.
Analytical specifications
| Chemical name | CJC-1295 + Ipamorelin |
|---|---|
| Class | Peptide blend / GHRH analog + growth-hormone secretagogue |
| Sequence | CJC No DAC: YDAIFTQSYRKVLAQLSARKLLQDILSR-NH₂ | Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ |
| Molecular weight | CJC No DAC: 3,367.9 g/mol | Ipamorelin: 711.85 g/mol |
| Molecular formula | CJC No DAC: C₁₅₂H₂₅₂N₄₄O₄₂ | Ipamorelin: C₃₈H₄₉N₉O₅ |
| CAS number | CJC No DAC: 863288-34-0 | Ipamorelin: 170851-70-4 |
| Purity | ≥ 99.3% (HPLC) |
| Identity | Confirmed by mass spectrometry |
| Form | Lyophilized powder |
| Amount | 10 mg per vial |
| Storage | Store lyophilized, protected from light |
| Current lot | VC-CP10-001 |
